PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT26446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 1561aa    MW: 167351 Da    PI: 6.451
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT26446genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.85.9e-09584626347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT eE e + +  + +G++ +++I++ ++ ++t  +c+++++k+
         EMT26446 584 PWTHEEKEVFMQMLASFGKN-FSKISNFLQ-HKTTADCVEFYYKH 626
                      8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-14567629IPR009057Homeodomain-like
PROSITE profilePS5129314.727580631IPR017884SANT domain
SMARTSM007172.2E-8581629IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-7583628IPR009057Homeodomain-like
PfamPF002491.4E-6583626IPR001005SANT/Myb domain
PROSITE profilePS5129314.846791842IPR017884SANT domain
SMARTSM007176.9E-5792840IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-8795837IPR009057Homeodomain-like
CDDcd001674.85E-4796834No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1561 aa     Download sequence    Send to blast
MAERARQSAT AGAASEKNAP SQSAAVADSQ SAEEETPRKK PRLGWGQGLA KYEKQKVPGS  60
SESAEPVAEG SPGGVEQKEV EGAPAPALCA SPVAAPAAQP SAPALCASPV AAPAAPSAPP  120
SSSPVPEDKS CELTTNTVTV SNKDIPGAEV QAYNDEIPIK LGQLDGDRIG SLANVLAELL  180
QHEDSCSGDS RRLTNSSKLL LLKENIAREL EKTELEIDSL ECELKSVSTE SENKALEDAQ  240
NPSPSSGTSK ILAKPATSKV LAKPETSKVL AKPEICGTSS SPKEQGVLTP CKLSVEQEAD  300
ANGVDLMDVV TAPVRGVTAV SSGESVACPG VVAEAQVAVA ADVAPLKPSE GTGSQIDAHC  360
PRQEPSLSHD NVSSMKADGS NALSTRQCSH HNDNRNLIPS IIAVNNDIAK EFNELVFKPL  420
PAGQPCLGLS SQMKNDLSVR KKLCMHKNRL RFKEQALTFK FKVLRHLWKE DVRLLSVRKQ  480
RPKSNKRTDQ SNRASQSGSQ RQRSSNRSRL GMPAGNLSTF PTTEISDVAN KMFTEFQFKR  540
CRNYLKMPAL IIDEKEKESA SFVSKNGLIE DPVSVEKERS VINPWTHEEK EVFMQMLASF  600
GKNFSKISNF LQHKTTADCV EFYYKHHKSD SFREVKKLLD LRQQQPTGNY LGTKSGKKWN  660
PENAASLDML GNAASVVAAH GLDYANRVEK DTEKSIIRTS CRSDVSAVAK GSFDKDGIAN  720
VSLHERESVA ADVLAGICGT LSPEGMGSCI TSSADHGQKI GATRMEYLIA TPEADKSFDE  780
EDDLSDQECE VDSVDWNDNE KSLFIEALNN HGKDFARISS YVKSKSYEQC KVFFSKARIS  840
LGLDLIYQQT TDTGLPTGDA SGGRSDTDEA CAAEMDSPIC STQSPVEMEM EVCPSADKTL  900
QGHLLSGITF KQSETDRSDG PDIVDLTFEE GEIKAEDTNN CNIPVHHGQS SEATHQSTPS  960
CAPIDINSSE STGSMENREH SNQVSVHGNG AMASSTEQSV GAHLEISSSL HNVEVIEPSK  1020
ASEKICTQVS SREHAPESCA PSSAGNLTTP VFLPGVIQSS NVYEGICTKE SSVERPSQQA  1080
PLSAHMKAGN LTLSVCLPGE QSSKVSSIEG PSKHAPESAH VKAGNLAPSV CLPGESGSKE  1140
NVAHFPDMAG VSCIRPAFTS SYQQSVPTDL LPAKPKSQVT PLTPKDLMPV QFSSDLPDPT  1200
SIRFEGIASI TSPNFGDHAN RVSNTPGPKD MNKFPVFNEQ SRSQHDVLFR NIDGYLQHRR  1260
NHHLAVDIPA FSDSTVSGSV GISHPDQFTI TKYQNGRSGS SGLSSSSAGF LMNGSSKELR  1320
EGQLKPCSHK ASTESCDQVK RPGDVKLFGK ILSHQSSLQS SGSSSNATRS KPPPPTTAAG  1380
LLGSGMDRMV YSSRPTNTAH FGQDERVVRS YTHLDGSTAQ PESSLFRVAK CQRSSLASVP  1440
FYSAKNGTLG VFAEYQQPLR QQLPSDPKRL ESYADLQKRN GIELISGFQQ QQQPGKAARL  1500
RGGGQQQPGK AARLGGAGIL VSPVSDPVAA LKAQYGSSSK FLGKDADHPW KDIGNRNLTD  1560
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C6e-16542633494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D6e-16542633494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLM8CRX80.0M8CRX8_AEGTA; Nuclear receptor corepressor 1
STRINGBRADI2G38160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-70MYB family protein